PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_002480_nawq.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 210aa    MW: 24463.2 Da    PI: 4.6767
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_002480_nawq.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-18456456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++f++eq++ Le+ Fe++ ++  +++ + A++lgL+ rqV +WFqN+Ra++k
  Bv1_002480_nawq.t1  4 KRRFSDEQVKSLESIFENETKLEPKKKVQVARELGLQPRQVAIWFQNKRARYK 56
                        568*************************************************9 PP

2HD-ZIP_I/II116.71.3e-37394293
         HD-ZIP_I/II  2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                        +krr+s+eqvk+LE+ Fe+e+kLep++Kv++areLglqprqva+WFqn+RAR+k+k+lEk+y++L+++y++l+++ e L+ke+++L  +l++
  Bv1_002480_nawq.t1  3 NKRRFSDEQVKSLESIFENETKLEPKKKVQVARELGLQPRQVAIWFQNKRARYKSKELEKNYTTLRSNYNSLAKRFEDLKKEKQSLVLQLQK 94
                        69************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.022158IPR001356Homeobox domain
SMARTSM003892.0E-15162IPR001356Homeobox domain
PfamPF000461.1E-15456IPR001356Homeobox domain
SuperFamilySSF466895.01E-16470IPR009057Homeodomain-like
CDDcd000861.98E-13459No hitNo description
Gene3DG3DSA:1.10.10.607.0E-18564IPR009057Homeodomain-like
PRINTSPR000312.3E-52938IPR000047Helix-turn-helix motif
PROSITE patternPS0002703356IPR017970Homeobox, conserved site
PRINTSPR000312.3E-53854IPR000047Helix-turn-helix motif
PfamPF021833.5E-105899IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MMNKRRFSDE QVKSLESIFE NETKLEPKKK VQVARELGLQ PRQVAIWFQN KRARYKSKEL  60
EKNYTTLRSN YNSLAKRFED LKKEKQSLVL QLQKLKEDLE EKEQGEKQCI KSQRDDESEN  120
KNNGKKSEEC EVKPALSLEG SEFGGCSMLS DEGSSENTNY FGVEDERDIL TMVQQPVDSS  180
LTSGEGWEDL HPDGLFDQAV ESCQWWDFWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692437.11e-152PREDICTED: homeobox-leucine zipper protein ATHB-12
SwissprotP468979e-60ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLA0A0J8D7911e-152A0A0J8D791_BETVU; Uncharacterized protein
STRINGVIT_15s0048g02870.t012e-72(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.21e-46homeobox 7